Lineage for d4raeb_ (4rae B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2148410Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2148411Protein automated matches [190151] (121 species)
    not a true protein
  7. 2149079Species Mycobacterium tuberculosis [TaxId:83332] [187938] (7 PDB entries)
  8. 2149097Domain d4raeb_: 4rae B: [277283]
    automated match to d3cq5a_

Details for d4raeb_

PDB Entry: 4rae (more details), 2.59 Å

PDB Description: crystal structure of rv1600 encoded aminotransferase from mycobacterium tuberculosis
PDB Compounds: (B:) Histidinol-phosphate aminotransferase

SCOPe Domain Sequences for d4raeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4raeb_ c.67.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
hpvtlddlplradlrgkapygapqlavpvrlntnenphpptralvddvvrsvreaaidlh
rypdrdavalradlagyltaqtgiqlgveniwaangsneilqqllqafggpgrsaigfvp
sysmhpiisdgthtewieasrandfgldvdvavaavvdrkpdvvfiaspnnpsgqsvslp
dlcklldvapgiaivdeaygefssqpsavslveeypsklvvtrtmskafafaggrlgyli
atpavidamllvrlpyhlssvtqaaaraalrhsddtlssvaaliaerervttslndmgfr
vipsdanfvlfgefadapaawrryleagilirdvgipgylrattglaeendaflrasari
atdlv

SCOPe Domain Coordinates for d4raeb_:

Click to download the PDB-style file with coordinates for d4raeb_.
(The format of our PDB-style files is described here.)

Timeline for d4raeb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4raea_