SCOP 1.59: Domain d1cgv_3: 1cgv 407-495

Lineage for d1cgv_3 (1cgv 407-495)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)

4. Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family)

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (12 proteins)

6. Protein Cyclodextrin glycosyltransferase [51018] (5 species)

7. Species Bacillus circulans, different strains [TaxId:1397] [51019] (29 PDB entries)

8. Domain d1cgv_3: 1cgv 407-495 [27727]
   Other proteins in same PDB: d1cgv_1, d1cgv_2, d1cgv_4

Details for d1cgv_3

PDB Entry: 1cgv, 2.5 Å

PDB Description: site directed mutations of the active site residue tyrosine 195 of cyclodextrin glycosyltransferase from bacillus circulans strain 251 affecting activity and product specificity

SCOP Domain Sequences for d1cgv_3:

Sequence; same for both SEQRES and ATOM records:

>d1cgv_3 b.71.1.1 (407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng
ntlsvgsggaasnftlaaggtavwqytaa

Timeline for d1cgv_3:

• d1cgv_3 first appeared (with stable ids) in SCOP 1.55
  
• d1cgv_3 appears in SCOP 1.57
  
• d1cgv_3 appears in SCOP 1.61
  
• d1cgv_3 appears in the current release, SCOPe 2.08, called d1cgva3