Lineage for d1cgv_3 (1cgv 407-495)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) 
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (10 proteins) Protein Cyclodextrin glycosyltransferase [51018] (5 species) 
Species Bacillus circulans, different strains [TaxId:1397] [51019] (27 PDB entries) 
Domain d1cgv_3: 1cgv 407-495 [27727]
Other proteins in same PDB: d1cgv_1, d1cgv_2, d1cgv_4
Details for d1cgv_3
PDB Entry: 1cgv (more details), 2.5 Å
PDB Description: site directed mutations of the active site residue tyrosine 195 of cyclodextrin glycosyltransferase from bacillus circulans strain 251 affecting activity and product specificity
SCOP Domain Sequences for d1cgv_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cgv_3 b.71.1.1 (407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng
ntlsvgsggaasnftlaaggtavwqytaa
SCOP Domain Coordinates for d1cgv_3:
Click to download the PDB-style file with coordinates for d1cgv_3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cgv_3:
- d1cgv_3 appears in SCOP 1.57
- d1cgv_3 appears in the current release, SCOPe 2.08, called d1cgva3
View in 3D
