Lineage for d5d8sl_ (5d8s L:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1989404Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1990371Protein automated matches [190041] (27 species)
    not a true protein
  7. 1990774Species Pseudomonas aeruginosa [TaxId:287] [189215] (12 PDB entries)
  8. 1990990Domain d5d8sl_: 5d8s L: [277245]
    automated match to d4e6ka_
    complexed with hem, k

Details for d5d8sl_

PDB Entry: 5d8s (more details), 2.55 Å

PDB Description: 2.55a resolution structure of bfrb (e85a) from pseudomonas aeruginosa
PDB Compounds: (L:) Ferroxidase

SCOPe Domain Sequences for d5d8sl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d8sl_ a.25.1.1 (L:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
rilfleglpnlqdlgklligentqamlqcdlnlelkatkdlreaivhceqvhdyvsrdll
kdileseeehidyletqlgliqkvglenylqshmhe

SCOPe Domain Coordinates for d5d8sl_:

Click to download the PDB-style file with coordinates for d5d8sl_.
(The format of our PDB-style files is described here.)

Timeline for d5d8sl_: