SCOP 1.75: Domain d1cgta3: 1cgt A:407-494

Lineage for d1cgta3 (1cgt A:407-494)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Cyclodextrin glycosyltransferase [51018] (6 species)
   contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like

7. Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries)

8. Domain d1cgta3: 1cgt A:407-494 [27722]
   Other proteins in same PDB: d1cgta1, d1cgta2, d1cgta4
   complexed with ca

Details for d1cgta3

PDB Entry: 1cgt, 2 Å

PDB Description: structure of cyclodextrin glycosyltransferase refined at 2.0 angstroms resolution

PDB Compounds: (A:) cyclodextrin glycosyl-transferase

SCOP Domain Sequences for d1cgta3:

Sequence; same for both SEQRES and ATOM records:

>d1cgta3 b.71.1.1 (A:407-494) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]}
gstqqrwinndvyvyerkfgksvavvavnrnlstsasitglstslptgsytdvlggvlng
nnitstngsinnftlaagatavwqytta

Timeline for d1cgta3:

• d1cgta3 first appeared (with stable ids) in SCOP 1.55, called d1cgt_3
  
• d1cgta3 appears in SCOP 1.73
  
• d1cgta3 appears in SCOPe 2.01
  
• d1cgta3 appears in the current release, SCOPe 2.08