| Class b: All beta proteins [48724] (178 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
| Protein Bacterial alpha-Amylase [51013] (9 species) |
| Species Bacillus stearothermophilus [TaxId:1422] [51017] (1 PDB entry) |
| Domain d1hvxa1: 1hvx A:394-483 [27721] Other proteins in same PDB: d1hvxa2 complexed with ca, na |
PDB Entry: 1hvx (more details), 2 Å
SCOPe Domain Sequences for d1hvxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hvxa1 b.71.1.1 (A:394-483) Bacterial alpha-Amylase {Bacillus stearothermophilus [TaxId: 1422]}
yaygtqhdyldhsdiigwtregvtekpgsglaalitdgpggskwmyvgkqhagkvfydlt
gnrsdtvtinsdgwgefkvnggsvsvwvpr
Timeline for d1hvxa1: