Lineage for d1hvxa1 (1hvx A:394-483)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) 
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (10 proteins) 
Protein Bacterial alpha-Amylase [51013] (4 species) 
Species Bacillus stearothermophilus [TaxId:1422] [51017] (1 PDB entry) 
Domain d1hvxa1: 1hvx A:394-483 [27721]
Other proteins in same PDB: d1hvxa2
Details for d1hvxa1
PDB Entry: 1hvx (more details), 2 Å
PDB Description: bacillus stearothermophilus alpha-amylase
SCOP Domain Sequences for d1hvxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hvxa1 b.71.1.1 (A:394-483) Bacterial alpha-Amylase {Bacillus stearothermophilus}
yaygtqhdyldhsdiigwtregvtekpgsglaalitdgpggskwmyvgkqhagkvfydlt
gnrsdtvtinsdgwgefkvnggsvsvwvpr
SCOP Domain Coordinates for d1hvxa1:
Click to download the PDB-style file with coordinates for d1hvxa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hvxa1:
- d1hvxa1 appears in SCOP 1.57
- d1hvxa1 appears in the current release, SCOPe 2.08
View in 3D
