![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Bacterial alpha-Amylase [51013] (9 species) |
![]() | Species Pseudoalteromonas haloplanktis [TaxId:228] [51015] (9 PDB entries) |
![]() | Domain d1aqma1: 1aqm A:355-448 [27717] Other proteins in same PDB: d1aqma2 complexed with ca, cl, trs |
PDB Entry: 1aqm (more details), 1.85 Å
SCOPe Domain Sequences for d1aqma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aqma1 b.71.1.1 (A:355-448) Bacterial alpha-Amylase {Pseudoalteromonas haloplanktis [TaxId: 228]} nwavtnwwdntnnqisfgrgssghmainkedstltatvqtdmasgqycnvlkgelsadak scsgevitvnsdgtinlnigawdamaihknakln
Timeline for d1aqma1: