Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) same topology as (b.1.15.1) |
Family b.1.30.0: automated matches [254306] (1 protein) not a true family |
Protein automated matches [254707] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255965] (11 PDB entries) |
Domain d5cu5a3: 5cu5 A:547-637 [277108] Other proteins in same PDB: d5cu5a1, d5cu5a2, d5cu5a4, d5cu5b1, d5cu5b2, d5cu5b4 automated match to d3se6a3 complexed with man, nag |
PDB Entry: 5cu5 (more details), 3.02 Å
SCOPe Domain Sequences for d5cu5a3:
Sequence, based on SEQRES records: (download)
>d5cu5a3 b.1.30.0 (A:547-637) automated matches {Human (Homo sapiens) [TaxId: 9606]} ipllvvkqdgcslrlqqerflqgvfqedpewralqerylwhipltystsssnvihrhilk sktdtldlpektswvkfnvdsngyyivhyeg
>d5cu5a3 b.1.30.0 (A:547-637) automated matches {Human (Homo sapiens) [TaxId: 9606]} ipllvvkqdgcslrlqqerflqgvfqerylwhipltystsssnvihrhilksktdtldlp ektswvkfnvdsngyyivhyeg
Timeline for d5cu5a3:
View in 3D Domains from other chains: (mouse over for more information) d5cu5b1, d5cu5b2, d5cu5b3, d5cu5b4 |