Lineage for d5auka_ (5auk A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933781Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 2933782Protein 2Fe-2S ferredoxin [54294] (19 species)
  7. 2933890Species Synechocystis sp. [TaxId:1111708] [277072] (2 PDB entries)
  8. 2933891Domain d5auka_: 5auk A: [277075]
    automated match to d1doya_
    complexed with ben, gak, so4

Details for d5auka_

PDB Entry: 5auk (more details), 1.62 Å

PDB Description: crystal structure of the ga-substituted ferredoxin
PDB Compounds: (A:) Ferredoxin-1

SCOPe Domain Sequences for d5auka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5auka_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Synechocystis sp. [TaxId: 1111708]}
asytvklitpdgessiecsddtyildaaeeagldlpyscragacstcagkitagsvdqsd
qsfldddqieagyvltcvayptsdctiethkeedly

SCOPe Domain Coordinates for d5auka_:

Click to download the PDB-style file with coordinates for d5auka_.
(The format of our PDB-style files is described here.)

Timeline for d5auka_: