SCOPe 2.05: Domain d4y86a_: 4y86 A:

Lineage for d4y86a_ (4y86 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109943] (19 PDB entries)
   Uniprot O76083 241-566

8. Domain d4y86a_: 4y86 A: [277032]
   automated match to d2hd1a_
   complexed with 49d, 49e, mg, zn

Details for d4y86a_

PDB Entry: 4y86, 2.01 Å

PDB Description: crystal structure of pde9 in complex with racemic inhibitor c33

PDB Compounds: (A:) High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A

SCOPe Domain Sequences for d4y86a_:

Sequence; same for both SEQRES and ATOM records:

>d4y86a_ a.211.1.2 (A:) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
kyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlfcvhd
nyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgynntyq
inartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitlilatd
marhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdclleey
fmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeimlqplw
esrdryeelkriddamkelqkk

Timeline for d4y86a_:

• d4y86a_ is new in SCOPe 2.05-stable
  
• d4y86a_ appears in SCOPe 2.06
  
• d4y86a_ appears in the current release, SCOPe 2.08