Lineage for d4y63a_ (4y63 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898744Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
    automatically mapped to Pfam PF03414
  6. 2898880Protein automated matches [190178] (2 species)
    not a true protein
  7. 2898887Species Human (Homo sapiens) [TaxId:9606] [186910] (75 PDB entries)
  8. 2898892Domain d4y63a_: 4y63 A: [277028]
    automated match to d3v0qa_
    complexed with 48o, bhe, mn

Details for d4y63a_

PDB Entry: 4y63 (more details), 1.3 Å

PDB Description: aaglyb in complex with amino-acid analogues
PDB Compounds: (A:) Histo-blood group ABO system transferase

SCOPe Domain Sequences for d4y63a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y63a_ c.68.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai
kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevraykrwqd
vsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssrea
ftyerrpqsqayipkdegdfyyggaffggsvqevqrltrachqammvdqangieavwhde
shlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavp

SCOPe Domain Coordinates for d4y63a_:

Click to download the PDB-style file with coordinates for d4y63a_.
(The format of our PDB-style files is described here.)

Timeline for d4y63a_: