Lineage for d4wv1a1 (4wv1 A:1-106)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1764974Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)
  8. 1765080Domain d4wv1a1: 4wv1 A:1-106 [277022]
    Other proteins in same PDB: d4wv1a2, d4wv1c_, d4wv1d2, d4wv1f_
    automated match to d1dn0a1

Details for d4wv1a1

PDB Entry: 4wv1 (more details), 2.36 Å

PDB Description: crystal structure of the fgfr2 d2 domain in complex with fab 2b.1.3
PDB Compounds: (A:) Fab light chain

SCOPe Domain Sequences for d4wv1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wv1a1 b.1.1.0 (A:1-106) automated matches {Homo sapiens [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqdvdtslawykqkpgkapklliysasflysgvps
rfsgsgsgtdftltisslqpedfatyycqqstghpqtfgqgtkvei

SCOPe Domain Coordinates for d4wv1a1:

Click to download the PDB-style file with coordinates for d4wv1a1.
(The format of our PDB-style files is described here.)

Timeline for d4wv1a1: