SCOPe 2.06: Domain d3vdhb_: 3vdh B:

Lineage for d3vdhb_ (3vdh B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (90 species)
   not a true protein

7. Species Prevotella bryantii [TaxId:77095] [276992] (6 PDB entries)

8. Domain d3vdhb_: 3vdh B: [276993]
   automated match to d4im4a_
   complexed with cl

Details for d3vdhb_

PDB Entry: 3vdh, 1.62 Å

PDB Description: crystal structure of pbgh5a, a glycoside hydrolase family 5 enzyme from prevotella bryantii b14

PDB Compounds: (B:) B-1,4-endoglucanase

SCOPe Domain Sequences for d3vdhb_:

Sequence; same for both SEQRES and ATOM records:

>d3vdhb_ c.1.8.0 (B:) automated matches {Prevotella bryantii [TaxId: 77095]}
atymeesaqsavdnfglgfnlgntldangcgtgkpvatyetfwgqpettqdmmtflmqng
fnavripvtwyehmdaegnvdeawmmrvkaiveyamnaglyaivnvhhdtaagsgawika
dtdvyaatkekfkklwtqianaladydqhllfegynemldgnnswdepqkasgyealnny
aqdfvdavratggnnatrnlivntyaaakgenvlnnfmlptdavnnhlivqvhsydpwnf
fntkttwdsechntlteifsalskkfttipyiigeygthgesdisvsksspaekiklaad
qaadmvklakdhhsatfywmsifdgsdriqpqwslptvveamqeayn

Timeline for d3vdhb_:

• d3vdhb_ first appeared in SCOPe 2.05
  
• d3vdhb_ appears in SCOPe 2.07
  
• d3vdhb_ appears in the current release, SCOPe 2.08