SCOPe 2.05: Domain d5di9b_: 5di9 B:

Lineage for d5di9b_ (5di9 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (5 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (21 PDB entries)

8. Domain d5di9b_: 5di9 B: [276962]
   Other proteins in same PDB: d5di9a_
   automated match to d4hawb_
   complexed with cl, gnp, gol, mg, zn; mutant

Details for d5di9b_

PDB Entry: 5di9, 2.28 Å

PDB Description: crystal structure of hrio2 nes reverse mutant peptide in complex with crm1-ran-ranbp1

PDB Compounds: (B:) Ran-specific GTPase-activating protein 1

SCOPe Domain Sequences for d5di9b_:

Sequence, based on SEQRES records:

>d5di9b_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hfepvvhlekvdvktmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvr
ilmrrdktlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgsken
adkfkeefekaqeinkk

Sequence, based on observed residues (ATOM records):

>d5di9b_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hfepvtmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdktl
kicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeefe
kaqeinkk

Timeline for d5di9b_:

• d5di9b_ is new in SCOPe 2.05-stable
  
• d5di9b_ appears in SCOPe 2.06
  
• d5di9b_ appears in the current release, SCOPe 2.08