Lineage for d5difb_ (5dif B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2071584Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2071585Protein automated matches [190052] (6 species)
    not a true protein
  7. 2071586Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (31 PDB entries)
  8. 2071602Domain d5difb_: 5dif B: [276959]
    Other proteins in same PDB: d5difa_
    automated match to d4hawb_
    complexed with cl, gnp, gol, mg

Details for d5difb_

PDB Entry: 5dif (more details), 2.09 Å

PDB Description: crystal structure of cpeb4 nes peptide in complex with crm1-ran-ranbp1
PDB Compounds: (B:) Ran-specific GTPase-activating protein 1

SCOPe Domain Sequences for d5difb_:

Sequence, based on SEQRES records: (download)

>d5difb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ihfepvvhlekvdvktmeedeevlykvraklfrfdadakewkergtgdckflknkktnkv
rilmrrdktlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgske
nadkfkeefekaqeinkk

Sequence, based on observed residues (ATOM records): (download)

>d5difb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ihfepvvtmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdk
tlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkee
fekaqeinkk

SCOPe Domain Coordinates for d5difb_:

Click to download the PDB-style file with coordinates for d5difb_.
(The format of our PDB-style files is described here.)

Timeline for d5difb_: