Class b: All beta proteins [48724] (180 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (8 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (63 PDB entries) |
Domain d5difb_: 5dif B: [276959] Other proteins in same PDB: d5difa_ automated match to d4hawb_ complexed with cl, gnp, gol, mg |
PDB Entry: 5dif (more details), 2.09 Å
SCOPe Domain Sequences for d5difb_:
Sequence, based on SEQRES records: (download)
>d5difb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ihfepvvhlekvdvktmeedeevlykvraklfrfdadakewkergtgdckflknkktnkv rilmrrdktlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgske nadkfkeefekaqeinkk
>d5difb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ihfepvvtmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdk tlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkee fekaqeinkk
Timeline for d5difb_: