Class b: All beta proteins [48724] (176 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.0: automated matches [191560] (1 protein) not a true family |
Protein automated matches [190967] (28 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:381754] [276926] (3 PDB entries) |
Domain d5dg3d_: 5dg3 D: [276948] automated match to d2qiaa_ complexed with po4, u21 |
PDB Entry: 5dg3 (more details), 2.3 Å
SCOPe Domain Sequences for d5dg3d_:
Sequence, based on SEQRES records: (download)
>d5dg3d_ b.81.1.0 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 381754]} lidpraiidpsarlaadvqvgpwsivgaeveigegtvigphvvlkgptkigkhnriyqfs svgedtpdlkykgeptrlvigdhnviregvtihrgtvqdraettigdhnlimayahighd svignhcilvnntalaghvhvddwailsgytlvhqycrigahsfsgmgsaigkdvpayvt vfgnpaearsmnfegmrrrgfsseaihalrraykvvyrqghtveealaelaesaaqfpev avfrdsiqsatrgitr
>d5dg3d_ b.81.1.0 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 381754]} lidpraiidpsarlaadvqvgpwsivgaeveigegtvigphvvlkgptkigkhnriyqfs svgedtpptrlvigdhnviregvtihrgtvqdraettigdhnlimayahighdsvignhc ilvnntalaghvhvddwailsgytlvhqycrigahsfsgmgsaigkdvpayvtvfgnpae arsmnfegmrrrgfsseaihalrraykvvyrqghtveealaelaesaaqfpevavfrdsi qsatrgitr
Timeline for d5dg3d_: