Lineage for d5dg3a_ (5dg3 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2814180Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2814181Protein automated matches [190967] (36 species)
    not a true protein
  7. 2814330Species Pseudomonas aeruginosa [TaxId:381754] [276926] (6 PDB entries)
  8. 2814355Domain d5dg3a_: 5dg3 A: [276947]
    automated match to d2qiaa_
    complexed with po4, u21

Details for d5dg3a_

PDB Entry: 5dg3 (more details), 2.3 Å

PDB Description: structure of pseudomonas aeruginosa lpxa in complex with udp-3-o-(r-3- hydroxydecanoyl)-glcnac
PDB Compounds: (A:) acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase

SCOPe Domain Sequences for d5dg3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dg3a_ b.81.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 381754]}
lidpraiidpsarlaadvqvgpwsivgaeveigegtvigphvvlkgptkigkhnriyqfs
svgedtpdlkykgeptrlvigdhnviregvtihrgtvqdraettigdhnlimayahighd
svignhcilvnntalaghvhvddwailsgytlvhqycrigahsfsgmgsaigkdvpayvt
vfgnpaearsmnfegmrrrgfsseaihalrraykvvyrqghtveealaelaesaaqfpev
avfrdsiqsatrgitr

SCOPe Domain Coordinates for d5dg3a_:

Click to download the PDB-style file with coordinates for d5dg3a_.
(The format of our PDB-style files is described here.)

Timeline for d5dg3a_: