Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
Protein automated matches [227126] (21 species) not a true protein |
Species Pseudomonas putida [TaxId:303] [254984] (38 PDB entries) |
Domain d5dgda3: 5dgd A:342-525 [276945] Other proteins in same PDB: d5dgda2 automated match to d1q6za3 complexed with ca, mg, tdp; mutant |
PDB Entry: 5dgd (more details), 1.13 Å
SCOPe Domain Sequences for d5dgda3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dgda3 c.36.1.0 (A:342-525) automated matches {Pseudomonas putida [TaxId: 303]} epakvdqdagrlhpetvfdtlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaag glgfalpaaigvqlaeperqviavigdgsanysisalwtaaqyniptifvimnngtygvl rwiagvleaenvpgldvpgidfralakgygvqalkadnleqlkgslqealsakgpvliev stvs
Timeline for d5dgda3: