SCOPe 2.05: Domain d5demf_: 5dem F:

Lineage for d5demf_ (5dem F:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (28 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:381754] [276926] (3 PDB entries)

8. Domain d5demf_: 5dem F: [276941]
   automated match to d2qiaa_
   complexed with po4

Details for d5demf_

PDB Entry: 5dem, 1.81 Å

PDB Description: structure of pseudomonas aeruginosa lpxa

PDB Compounds: (F:) acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase

SCOPe Domain Sequences for d5demf_:

Sequence; same for both SEQRES and ATOM records:

>d5demf_ b.81.1.0 (F:) automated matches {Pseudomonas aeruginosa [TaxId: 381754]}
slidpraiidpsarlaadvqvgpwsivgaeveigegtvigphvvlkgptkigkhnriyqf
ssvgedtpdlkykgeptrlvigdhnviregvtihrgtvqdraettigdhnlimayahigh
dsvignhcilvnntalaghvhvddwailsgytlvhqycrigahsfsgmgsaigkdvpayv
tvfgnpaearsmnfegmrrrgfsseaihalrraykvvyrqghtveealaelaesaaqfpe
vavfrdsiqsatrgitr

Timeline for d5demf_:

• d5demf_ is new in SCOPe 2.05-stable
  
• d5demf_ appears in SCOPe 2.06
  
• d5demf_ appears in the current release, SCOPe 2.08