SCOPe 2.05: Domain d5depa_: 5dep A:

Lineage for d5depa_ (5dep A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (28 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:381754] [276926] (3 PDB entries)

8. Domain d5depa_: 5dep A: [276930]
   automated match to d2qiaa_
   complexed with po4, ud1

Details for d5depa_

PDB Entry: 5dep, 2.16 Å

PDB Description: structure of pseudomonas aeruginosa lpxa in complex with udp-glcnac

PDB Compounds: (A:) acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase

SCOPe Domain Sequences for d5depa_:

Sequence; same for both SEQRES and ATOM records:

>d5depa_ b.81.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 381754]}
mslidpraiidpsarlaadvqvgpwsivgaeveigegtvigphvvlkgptkigkhnriyq
fssvgedtpdlkykgeptrlvigdhnviregvtihrgtvqdraettigdhnlimayahig
hdsvignhcilvnntalaghvhvddwailsgytlvhqycrigahsfsgmgsaigkdvpay
vtvfgnpaearsmnfegmrrrgfsseaihalrraykvvyrqghtveealaelaesaaqfp
evavfrdsiqsatrgitr

Timeline for d5depa_:

• d5depa_ is new in SCOPe 2.05-stable
  
• d5depa_ appears in SCOPe 2.06
  
• d5depa_ appears in the current release, SCOPe 2.08