Lineage for d5deia3 (5dei A:343-526)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2472772Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2472773Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2473412Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2473413Protein automated matches [227126] (21 species)
    not a true protein
  7. 2473641Species Pseudomonas putida [TaxId:303] [254984] (38 PDB entries)
  8. 2473681Domain d5deia3: 5dei A:343-526 [276919]
    Other proteins in same PDB: d5deia2, d5deib2, d5deic2, d5deid2
    automated match to d1q6za3
    complexed with bct, ca, mg, tdp

Details for d5deia3

PDB Entry: 5dei (more details), 1.3 Å

PDB Description: benzoylformate decarboxylase from pseudomonas putida
PDB Compounds: (A:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d5deia3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5deia3 c.36.1.0 (A:343-526) automated matches {Pseudomonas putida [TaxId: 303]}
epakvdqdagrlhpetvfdtlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaag
glgfalpaaigvqlaeperqviavigdgsanysisalwtaaqyniptifvimnngtygal
rwfagvleaenvpgldvpgidfralakgygvqalkadnleqlkgslqealsakgpvliev
stvs

SCOPe Domain Coordinates for d5deia3:

Click to download the PDB-style file with coordinates for d5deia3.
(The format of our PDB-style files is described here.)

Timeline for d5deia3: