SCOPe 2.06: Domain d5dd7a2: 5dd7 A:137-305

Lineage for d5dd7a2 (5dd7 A:137-305)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.0: automated matches [227182] (1 protein)
   not a true family

6. Protein automated matches [226902] (11 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [276304] (3 PDB entries)

8. Domain d5dd7a2: 5dd7 A:137-305 [276912]
   Other proteins in same PDB: d5dd7a1, d5dd7b1
   automated match to d3mcqa2
   complexed with anp, edo, k, mg, tps

Details for d5dd7a2

PDB Entry: 5dd7, 1.7 Å

PDB Description: structure of thiamine-monophosphate kinase from acinetobacter baumannii in complex with amppnp and thiamine-monophosphate

PDB Compounds: (A:) Thiamine-monophosphate kinase

SCOPe Domain Sequences for d5dd7a2:

Sequence; same for both SEQRES and ATOM records:

>d5dd7a2 d.139.1.0 (A:137-305) automated matches {Acinetobacter baumannii [TaxId: 470]}
tgkavlrsgakvgdyvcvsgqigdaayglqhlghslqqrldyptprcklgeelkglassm
idvsdglaqdlghilkaskvgarlileklpvdpvlqqieeqqrwqyalaggddyelcfti
tpqnyekllqkqldvkitmigqiveqtkltfehlgsdyplqihgyqhfa

Timeline for d5dd7a2:

• d5dd7a2 first appeared in SCOPe 2.05
  
• d5dd7a2 appears in SCOPe 2.07
  
• d5dd7a2 appears in the current release, SCOPe 2.08