SCOPe 2.08: Domain d5cvuc1: 5cvu C:15-122

Lineage for d5cvuc1 (5cvu C:15-122)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Clarkia breweri [TaxId:36903] [226317] (5 PDB entries)

8. Domain d5cvuc1: 5cvu C:15-122 [276907]
   Other proteins in same PDB: d5cvua2, d5cvub2, d5cvuc2, d5cvud2
   automated match to d1kyze1
   complexed with 55b, no3, sah

Details for d5cvuc1

PDB Entry: 5cvu, 1.8 Å

PDB Description: sinpyl alcohol bound monolignol 4-o-methyltransferase 5

PDB Compounds: (C:) (Iso)eugenol O-methyltransferase

SCOPe Domain Sequences for d5cvuc1:

Sequence; same for both SEQRES and ATOM records:

>d5cvuc1 a.4.5.0 (C:15-122) automated matches {Clarkia breweri [TaxId: 36903]}
hssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyispaeiaaqlpttnp
eapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltkne

Timeline for d5cvuc1:

• d5cvuc1 first appeared in SCOPe 2.05
  
• d5cvuc1 appears in SCOPe 2.07