SCOPe 2.05: Domain d5cvvb1: 5cvv B:16-122

Lineage for d5cvvb1 (5cvv B:16-122)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (57 species)
   not a true protein

7. Species Clarkia breweri [TaxId:36903] [226317] (5 PDB entries)

8. Domain d5cvvb1: 5cvv B:16-122 [276889]
   Other proteins in same PDB: d5cvva2, d5cvvb2
   automated match to d1kyze1
   complexed with n7i, sah

Details for d5cvvb1

PDB Entry: 5cvv, 1.73 Å

PDB Description: coniferyl alcohol bound monolignol 4-o-methyltransferase 9

PDB Compounds: (B:) (Iso)eugenol O-methyltransferase

SCOPe Domain Sequences for d5cvvb1:

Sequence, based on SEQRES records:

>d5cvvb1 a.4.5.0 (B:16-122) automated matches {Clarkia breweri [TaxId: 36903]}
ssdeeanlfahqlaraaslpmalkaaieldvleimaksvppsgyispaeiaaqlpttnpe
apvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltkne

Sequence, based on observed residues (ATOM records):

>d5cvvb1 a.4.5.0 (B:16-122) automated matches {Clarkia breweri [TaxId: 36903]}
ssdeeanlfahqlaraaslpmalkaaieldvleimaksvppsgyispaeiaaqlpttnpe
apvmldrvlrllasysvvtytlrverlyglapvckfltkne

Timeline for d5cvvb1:

• d5cvvb1 is new in SCOPe 2.05-stable
  
• d5cvvb1 appears in SCOPe 2.06
  
• d5cvvb1 appears in the current release, SCOPe 2.08