SCOPe 2.05: Domain d4zexb_: 4zex B:

Lineage for d4zexb_ (4zex B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (49 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [258369] (4 PDB entries)

8. Domain d4zexb_: 4zex B: [276862]
   automated match to d2b30a1
   complexed with g3h, mg, po4

Details for d4zexb_

PDB Entry: 4zex, 2 Å

PDB Description: crystal structure of pfhad1 in complex with glyceraldehyde-3-phosphate

PDB Compounds: (B:) PfHAD1

SCOPe Domain Sequences for d4zexb_:

Sequence; same for both SEQRES and ATOM records:

>d4zexb_ c.108.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
ndeikiiftaldgtllnsenkvseqnlesliraqekgikvviatgrsifsvenvigehvk
knrisllpgiymngcvtfdekgsrvidrimnndlkmeihefskqiniskyaiwfclekty
cfeindcireymevealnpdviednmlegltvykvlfslpenilentlklcrekfshrin
vantfqsyvelfhqhtnkfegvkeickyynislnnalamgdgendiemlsglthsvgvhn
asekvknsaayvgpsnnehaishvlktfcd

Timeline for d4zexb_:

• d4zexb_ is new in SCOPe 2.05-stable
  
• d4zexb_ appears in SCOPe 2.06
  
• d4zexb_ appears in the current release, SCOPe 2.08