Lineage for d4yw7n_ (4yw7 N:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776981Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1776982Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 1777493Family b.18.1.16: PA-IL, galactose-binding lectin 1 [82022] (1 protein)
    a truncated form of this fold lacking one of the N-terminal strands
    automatically mapped to Pfam PF07828
  6. 1777494Protein PA-IL, galactose-binding lectin 1 [82023] (1 species)
  7. 1777495Species Pseudomonas aeruginosa [TaxId:287] [82024] (18 PDB entries)
  8. 1777576Domain d4yw7n_: 4yw7 N: [276859]
    automated match to d1l7la_
    complexed with 4j0, ca, gal

Details for d4yw7n_

PDB Entry: 4yw7 (more details), 1.82 Å

PDB Description: structural insight into divalent galactoside binding to pseudomonas aeruginosa lectin leca
PDB Compounds: (N:) PA-I galactophilic lectin

SCOPe Domain Sequences for d4yw7n_:

Sequence, based on SEQRES records: (download)

>d4yw7n_ b.18.1.16 (N:) PA-IL, galactose-binding lectin 1 {Pseudomonas aeruginosa [TaxId: 287]}
awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
s

Sequence, based on observed residues (ATOM records): (download)

>d4yw7n_ b.18.1.16 (N:) PA-IL, galactose-binding lectin 1 {Pseudomonas aeruginosa [TaxId: 287]}
awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
fcgalvmkignsgtipvntglfrwvanvqgaitliyndvpgtygnnsgsfsvnigkdqs

SCOPe Domain Coordinates for d4yw7n_:

Click to download the PDB-style file with coordinates for d4yw7n_.
(The format of our PDB-style files is described here.)

Timeline for d4yw7n_: