Lineage for d1flgb_ (1flg B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17239Fold b.70: 8-bladed beta-propeller [50997] (2 superfamilies)
  4. 17240Superfamily b.70.1: Quinoprotein alcohol dehydrogenase [50998] (1 family) (S)
  5. 17241Family b.70.1.1: Quinoprotein alcohol dehydrogenase [50999] (2 proteins)
  6. 17242Protein Ethanol dehydrogenase [51002] (1 species)
  7. 17243Species Pseudomonas aeruginosa [TaxId:287] [51003] (1 PDB entry)
  8. 17245Domain d1flgb_: 1flg B: [27683]

Details for d1flgb_

PDB Entry: 1flg (more details), 2.6 Å

PDB Description: crystal structure of the quinoprotein ethanol dehydrogenase from pseudomonas aeruginosa

SCOP Domain Sequences for d1flgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1flgb_ b.70.1.1 (B:) Ethanol dehydrogenase {Pseudomonas aeruginosa}
kdvtwedianddkttgdvlqygmgthaqrwsplkqvnadnvfkltpawsysfgdekqrgq
esqaivsdgviyvtasysrlfaldaktgkrlwtynhrlpddirpccdvvnrgaaiygdkv
ffgtldasvvalnkntgkvvwkkkfadhgagytmtgaptivkdgktgkvllihgssgdef
gvvgrlfardpdtgeeiwmrpfveghmgrlngkdstvtgdvkapswpddrnsptgkvesw
shgggapwqsasfdaetntiivgagnpgpwntwartakggnphdydslytsgqvgvdpss
gevkwfyqhtpndawdfsgnnelvlfdykakdgkivkatahadrngffyvvdrsngklqn
afpfvdnitwashidlktgrpveregqrpplpepgqkhgkavevsppflggknwnpmays
qdtglfyvpanhwkedywteevsytkgsaylgmgfrikrmyddhvgslramdpvsgkvvw
ehkehlplwagvlatagnlvftgtgdgyfkafdaksgkelwkfqtgsgivsppitweqdg
eqylgvtvgyggavplwggdmadltrpvaqggsfwvfklpsw

SCOP Domain Coordinates for d1flgb_:

Click to download the PDB-style file with coordinates for d1flgb_.
(The format of our PDB-style files is described here.)

Timeline for d1flgb_:

Domains from other chains:
(mouse over for more information)
d1flga_