SCOPe 2.06: Domain d4yuxa_: 4yux A:

Lineage for d4yuxa_ (4yux A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (64 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:353153] [188400] (11 PDB entries)

8. Domain d4yuxa_: 4yux A: [276829]
   automated match to d2o06a_
   complexed with 4jt, s4m

Details for d4yuxa_

PDB Entry: 4yux, 1.6 Å

PDB Description: crystal structure of trypanosoma cruzi spermidine synthase in complex with 2h-1,4-benzothiazin-3-amine

PDB Compounds: (A:) Spermidine synthase, putative

SCOPe Domain Sequences for d4yuxa_:

Sequence; same for both SEQRES and ATOM records:

>d4yuxa_ c.66.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
pgselisggwfreendqwpgqamslrvekvlydaptkfqhltifesdpkgpwgtvmaldg
ciqvtdydefvyhevlghtslcshpkpervliigggdggvlrevlrhgtvehcdlvdidg
evmeqskqhfpqisrsladpratvrvgdglafvrqtpdntydvviidttdpagpasklfg
eafykdvlrilkpdgiccnqgesiwldleliekmsrfiretgfasvqyalmhvptypcgs
igtlvcskkagvdvtkplrpvedmpfakdlkyydsemhkasfalprfarhinn

Timeline for d4yuxa_:

• d4yuxa_ first appeared in SCOPe 2.05
  
• d4yuxa_ appears in SCOPe 2.07
  
• d4yuxa_ appears in the current release, SCOPe 2.08