Lineage for d4yuwa_ (4yuw A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864482Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1864483Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1865706Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1865707Protein automated matches [190689] (49 species)
    not a true protein
  7. 1866015Species Trypanosoma cruzi [TaxId:353153] [188400] (10 PDB entries)
  8. 1866038Domain d4yuwa_: 4yuw A: [276826]
    automated match to d2o06a_
    complexed with 4ju, s4m

Details for d4yuwa_

PDB Entry: 4yuw (more details), 1.97 Å

PDB Description: crystal structure of trypanosoma cruzi spermidine synthase in complex with trans-4-methylcyclohexylamine
PDB Compounds: (A:) Spermidine synthase, putative

SCOPe Domain Sequences for d4yuwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yuwa_ c.66.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
mpgselisggwfreendqwpgqamslrvekvlydaptkfqhltifesdpkgpwgtvmald
gciqvtdydefvyhevlghtslcshpkpervliigggdggvlrevlrhgtvehcdlvdid
gevmeqskqhfpqisrsladpratvrvgdglafvrqtpdntydvviidttdpagpasklf
geafykdvlrilkpdgiccnqgesiwldleliekmsrfiretgfasvqyalmhvptypcg
sigtlvcskkagvdvtkplrpvedmpfakdlkyydsemhkasfalprfarhinn

SCOPe Domain Coordinates for d4yuwa_:

Click to download the PDB-style file with coordinates for d4yuwa_.
(The format of our PDB-style files is described here.)

Timeline for d4yuwa_: