![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (37 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187655] (48 PDB entries) |
![]() | Domain d4ym2b_: 4ym2 B: [276821] automated match to d2zhma_ complexed with bgc, lat, sga |
PDB Entry: 4ym2 (more details), 2.1 Å
SCOPe Domain Sequences for d4ym2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ym2b_ b.29.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ptfnppvpyfgrlqggltarrtiiikgyvpptgksfainfkvgssgdialhinprmgngt vvrnsllngswgseekkithnpfgpgqffdlsircgldrfkvyangqhlfdfahrlsafq rvdtleiqgdvtlsyvqi
Timeline for d4ym2b_: