Lineage for d1g72c_ (1g72 C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17239Fold b.70: 8-bladed beta-propeller [50997] (2 superfamilies)
  4. 17240Superfamily b.70.1: Quinoprotein alcohol dehydrogenase [50998] (1 family) (S)
  5. 17241Family b.70.1.1: Quinoprotein alcohol dehydrogenase [50999] (2 proteins)
  6. 17246Protein Methanol dehydrogenase, heavy chain [51000] (1 species)
  7. 17247Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51001] (2 PDB entries)
  8. 17249Domain d1g72c_: 1g72 C: [27681]
    Other proteins in same PDB: d1g72b_, d1g72d_

Details for d1g72c_

PDB Entry: 1g72 (more details), 1.9 Å

PDB Description: catalytic mechanism of quinoprotein methanol dehydrogenase: a theoretical and x-ray crystallographic investigation

SCOP Domain Sequences for d1g72c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g72c_ b.70.1.1 (C:) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1}
dadldkqvntagawpiatggyysqhnsplaqinksnvknvkaawsfstgvlnghegaplv
igdmmyvhsafpnntyalnlndpgkivwqhkpkqdastkavmccdvvdrglaygagqivk
kqanghllaldaktgkinwevevcdpkvgstltqapfvakdtvlmgcsgaelgvrgavna
fdlktgelkwrafatgsddsvrlakdfnsanphygqfglgtktwegdawkigggtnwgwy
aydpklnlfyygsgnpapwnetmrpgdnkwtmtiwgrdldtgmakwgyqktphdewdfag
vnqmvltdqpvngkmtpllshidrngilytlnrengnlivaekvdpavnvfkkvdlktgt
pvrdpefatrmdhkgtnicpsamgfhnqgvdsydpesrtlyaglnhicmdwepfmlpyra
gqffvgatlamypgpngptkkemgqirafdlttgkakwtkwekfaawggtlytkgglvwy
atldgylkaldnkdgkelwnfkmpsggigspmtysfkgkqyigsmygvggwpgvglvfdl
tdpsaglgavgafrelqnhtqmggglmvfsl

SCOP Domain Coordinates for d1g72c_:

Click to download the PDB-style file with coordinates for d1g72c_.
(The format of our PDB-style files is described here.)

Timeline for d1g72c_: