SCOPe 2.05: Domain d4yika_: 4yik A:

Lineage for d4yika_ (4yik A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.8: 5'(3')-deoxyribonucleotidase (dNT-2) [82382] (2 proteins)
   the insertion subdomain is a 4-helical bundle; dephosphorylates dUMP and dTMP
   automatically mapped to Pfam PF06941

6. Protein automated matches [190171] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186899] (17 PDB entries)

8. Domain d4yika_: 4yik A: [276809]
   automated match to d4l6aa_
   complexed with 2o2, gol, mg, peg, po4, trs

Details for d4yika_

PDB Entry: 4yik, 1.48 Å

PDB Description: crystal structure of human cytosolic 5'(3')-deoxyribonucleotidase in complex with the inhibitor pb-pvu

PDB Compounds: (A:) 5'(3')-deoxyribonucleotidase, mitochondrial

SCOPe Domain Sequences for d4yika_:

Sequence; same for both SEQRES and ATOM records:

>d4yika_ c.108.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
snaasggralrvlvdmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrp
glsekaisiwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyaw
vekyfgpdfleqivltrdktvvsadlliddrpditgaeptpswehvlftachnqhlqlqp
prrrlhswaddwkaildskrp

Timeline for d4yika_:

• d4yika_ is new in SCOPe 2.05-stable
  
• d4yika_ is called d4yika1 in SCOPe 2.06
  
• d4yika_ appears in the current release, SCOPe 2.08, called d4yika1