SCOPe 2.05: Domain d4xerb_: 4xer B:

Lineage for d4xerb_ (4xer B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.106: SurE-like [64166] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7

4. Superfamily c.106.1: SurE-like [64167] (2 families)
   some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family

5. Family c.106.1.0: automated matches [191430] (1 protein)
   not a true family

6. Protein automated matches [190619] (6 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:99287] [196119] (10 PDB entries)

8. Domain d4xerb_: 4xer B: [276782]
   automated match to d2v4od_
   complexed with act, ca, mg, mpd, po4; mutant

Details for d4xerb_

PDB Entry: 4xer, 1.97 Å

PDB Description: crystal structure of c2 form of e112a/h234a mutant of stationary phase survival protein (sure) from salmonella typhimurium

PDB Compounds: (B:) 5'/3'-nucleotidase SurE

SCOPe Domain Sequences for d4xerb_:

Sequence; same for both SEQRES and ATOM records:

>d4xerb_ c.106.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 99287]}
gmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftf
dngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamagrhl
gfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrc
gsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltaasa
hdvvsdwldsvgvgtqw

Timeline for d4xerb_:

• d4xerb_ is new in SCOPe 2.05-stable
  
• d4xerb_ is called d4xerb1 in SCOPe 2.06
  
• d4xerb_ appears in the current release, SCOPe 2.08, called d4xerb1