SCOPe 2.05: Domain d4x6ja_: 4x6j A:

Lineage for d4x6ja_ (4x6j A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin K [54028] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54029] (45 PDB entries)
   Uniprot P43235 116-329 ! Uniprot P43235 115-329

8. Domain d4x6ja_: 4x6j A: [276779]
   automated match to d1tu6a_
   complexed with 3y2, cl, gol, k, pgo

Details for d4x6ja_

PDB Entry: 4x6j, 1.59 Å

PDB Description: development of n-(functionalized benzoyl)-homocycloleucyl- glycinonitriles as potent cathepsin k inhibitors.

PDB Compounds: (A:) cathepsin k

SCOPe Domain Sequences for d4x6ja_:

Sequence; same for both SEQRES and ATOM records:

>d4x6ja_ d.3.1.1 (A:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm

Timeline for d4x6ja_:

• d4x6ja_ is new in SCOPe 2.05-stable
  
• d4x6ja_ appears in SCOPe 2.06
  
• d4x6ja_ appears in the current release, SCOPe 2.08