Lineage for d4x42c_ (4x42 C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2039515Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2039516Protein automated matches [190226] (55 species)
    not a true protein
  7. 2039604Species Dengue virus type 4 [TaxId:408871] [236276] (2 PDB entries)
  8. 2039609Domain d4x42c_: 4x42 C: [276776]
    Other proteins in same PDB: d4x42b2, d4x42d2, d4x42f2
    automated match to d2h0pa_
    complexed with so4; mutant

Details for d4x42c_

PDB Entry: 4x42 (more details), 2.78 Å

PDB Description: crystal structure of den4 ed3 mutant with epitope two residues substituted from den3 ed3
PDB Compounds: (C:) Envelope protein E

SCOPe Domain Sequences for d4x42c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x42c_ b.1.18.0 (C:) automated matches {Dengue virus type 4 [TaxId: 408871]}
sytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpl
aentnsvtnieleppfgdsyivigvgdkalklnwfrk

SCOPe Domain Coordinates for d4x42c_:

Click to download the PDB-style file with coordinates for d4x42c_.
(The format of our PDB-style files is described here.)

Timeline for d4x42c_: