SCOPe 2.05: Domain d4r9hd_: 4r9h D:

Lineage for d4r9hd_ (4r9h D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88602] (388 PDB entries)
   Uniprot P61769 21-119 ! Uniprot P01884

8. Domain d4r9hd_: 4r9h D: [276734]
   automated match to d1k5nb_
   mutant

Details for d4r9hd_

PDB Entry: 4r9h, 1.9 Å

PDB Description: crystal structure of dimeric s33c beta-2 microglobulin mutant at 1.9 angstrom resolution

PDB Compounds: (D:) Beta-2-microglobulin

SCOPe Domain Sequences for d4r9hd_:

Sequence; same for both SEQRES and ATOM records:

>d4r9hd_ b.1.1.2 (D:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
miqrtpkiqvysrhpaengksnflncyvsgfhpcdievdllkngeriekvehsdlsfskd
wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdr

Timeline for d4r9hd_:

• d4r9hd_ is new in SCOPe 2.05-stable
  
• d4r9hd_ is called d4r9hd1 in SCOPe 2.06
  
• d4r9hd_ appears in the current release, SCOPe 2.08, called d4r9hd1