Lineage for d4r6ec2 (4r6e C:797-1010)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233860Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2233861Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2234147Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2234148Protein automated matches [191197] (9 species)
    not a true protein
  7. 2234201Species Human (Homo sapiens) [TaxId:9606] [225406] (38 PDB entries)
  8. 2234240Domain d4r6ec2: 4r6e C:797-1010 [276720]
    Other proteins in same PDB: d4r6ea1, d4r6eb1, d4r6ec1, d4r6ed1
    automated match to d4hhyd2
    protein/DNA complex; complexed with 3jd, gol, so4

Details for d4r6ec2

PDB Entry: 4r6e (more details), 2.2 Å

PDB Description: human artd1 (parp1) - catalytic domain in complex with inhibitor niraparib
PDB Compounds: (C:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4r6ec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r6ec2 d.166.1.0 (C:797-1010) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfk

SCOPe Domain Coordinates for d4r6ec2:

Click to download the PDB-style file with coordinates for d4r6ec2.
(The format of our PDB-style files is described here.)

Timeline for d4r6ec2: