Lineage for d1bpoc2 (1bpo C:1-330)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2809391Superfamily b.69.6: Clathrin heavy-chain terminal domain [50989] (1 family) (S)
  5. 2809392Family b.69.6.1: Clathrin heavy-chain terminal domain [50990] (2 proteins)
  6. 2809393Protein Clathrin heavy-chain terminal domain [50991] (1 species)
  7. 2809394Species Norway rat (Rattus norvegicus) [TaxId:10116] [50992] (5 PDB entries)
  8. 2809400Domain d1bpoc2: 1bpo C:1-330 [27672]
    Other proteins in same PDB: d1bpoa1, d1bpob1, d1bpoc1

Details for d1bpoc2

PDB Entry: 1bpo (more details), 2.6 Å

PDB Description: clathrin heavy-chain terminal domain and linker
PDB Compounds: (C:) protein (clathrin)

SCOPe Domain Sequences for d1bpoc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bpoc2 b.69.6.1 (C:1-330) Clathrin heavy-chain terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
etifvtapheatagiigvnrkgqvlsvcve

SCOPe Domain Coordinates for d1bpoc2:

Click to download the PDB-style file with coordinates for d1bpoc2.
(The format of our PDB-style files is described here.)

Timeline for d1bpoc2: