SCOPe 2.05: Domain d2ms4a_: 2ms4 A:

Lineage for d2ms4a_ (2ms4 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein Cyclophilin (eukaryotic) [50893] (13 species)

7. Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (78 PDB entries)
   Uniprot P05092

8. Domain d2ms4a_: 2ms4 A: [276717]
   automated match to d1w8ma_

Details for d2ms4a_

PDB Entry: 2ms4

PDB Description: cyclophilin a complexed with a fragment of crk-ii

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase A

SCOPe Domain Sequences for d2ms4a_:

Sequence; same for both SEQRES and ATOM records:

>d2ms4a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

Timeline for d2ms4a_:

• d2ms4a_ is new in SCOPe 2.05-stable
  
• d2ms4a_ appears in SCOPe 2.06
  
• d2ms4a_ appears in the current release, SCOPe 2.08