SCOPe 2.06: Domain d5da4a_: 5da4 A:

Lineage for d5da4a_ (5da4 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)

8. Domain d5da4a_: 5da4 A: [276710]
   automated match to d4w81a_

Details for d5da4a_

PDB Entry: 5da4, 2.4 Å

PDB Description: structure of a nanobody recognizing the fumarate transporter slc26dg

PDB Compounds: (A:) Nanobody recognizing the membrane protein SLC26Dg

SCOPe Domain Sequences for d5da4a_:

Sequence; same for both SEQRES and ATOM records:

>d5da4a_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
sqvqlqesggglvqaggslrlscaasgrtfssdvmgwfrqapgkerefvaavtrsggksy
nadsvkgrftisrdnakntvslqmnslkpedtavyycaagdtaitswygydywgqgtqvt
vss

Timeline for d5da4a_:

• d5da4a_ first appeared in SCOPe 2.05
  
• d5da4a_ appears in SCOPe 2.07
  
• d5da4a_ appears in the current release, SCOPe 2.08, called d5da4a1