Lineage for d5cuaa1 (5cua A:1858-1970)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993780Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1993781Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1993941Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1993942Protein automated matches [190615] (10 species)
    not a true protein
  7. 1993960Species Human (Homo sapiens) [TaxId:9606] [187641] (647 PDB entries)
  8. 1994614Domain d5cuaa1: 5cua A:1858-1970 [276692]
    Other proteins in same PDB: d5cuaa2
    automated match to d4rvra_
    complexed with 54u, edo

Details for d5cuaa1

PDB Entry: 5cua (more details), 1.89 Å

PDB Description: crystal structure of the bromodomain of bromodomain adjacent to zinc finger domain protein 2b (baz2b) in complex with 1-acetyl-4-(4- hydroxyphenyl)piperazine (sgc - diamond i04-1 fragment screening)
PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2B

SCOPe Domain Sequences for d5cuaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cuaa1 a.29.2.0 (A:1858-1970) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstirek
lssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfk

SCOPe Domain Coordinates for d5cuaa1:

Click to download the PDB-style file with coordinates for d5cuaa1.
(The format of our PDB-style files is described here.)

Timeline for d5cuaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5cuaa2