SCOPe 2.08: Domain d5ciqb_: 5ciq B:

Lineage for d5ciqb_ (5ciq B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ran [52609] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52611] (90 PDB entries)

8. Domain d5ciqb_: 5ciq B: [276664]
   automated match to d1a2ke_
   complexed with gdp, mg
   has additional insertions and/or extensions that are not grouped together

Details for d5ciqb_

PDB Entry: 5ciq, 1.65 Å

PDB Description: ran gdp wild type tetragonal crystal form

PDB Compounds: (B:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d5ciqb_:

Sequence; same for both SEQRES and ATOM records:

>d5ciqb_ c.37.1.8 (B:) Ran {Human (Homo sapiens) [TaxId: 9606]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqyehdlevaqtt

Timeline for d5ciqb_:

• d5ciqb_ first appeared in SCOPe 2.05
  
• d5ciqb_ appears in SCOPe 2.07