SCOPe 2.06: Domain d5ciwb_: 5ciw B:

Lineage for d5ciwb_ (5ciw B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ran [52609] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52611] (43 PDB entries)

8. Domain d5ciwb_: 5ciw B: [276662]
   automated match to d2mmca_
   complexed with gdp, mg; mutant

Details for d5ciwb_

PDB Entry: 5ciw, 1.75 Å

PDB Description: ran gdp y39a mutant monoclinic crystal form

PDB Compounds: (B:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d5ciwb_:

Sequence; same for both SEQRES and ATOM records:

>d5ciwb_ c.37.1.8 (B:) Ran {Human (Homo sapiens) [TaxId: 9606]}
vqfklvlvgdggtgkttfvkrhltgefekkavatlgvevhplvfhtnrgpikfnvwdtag
qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappevv
mdpalaaqyehdlevaqtt

Timeline for d5ciwb_:

• d5ciwb_ first appeared in SCOPe 2.05
  
• d5ciwb_ appears in SCOPe 2.07
  
• d5ciwb_ appears in the current release, SCOPe 2.08