Lineage for d5agfa_ (5agf A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1726514Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1726557Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 1726709Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
    automatically mapped to Pfam PF01322
  6. 1726754Protein automated matches [190363] (4 species)
    not a true protein
  7. 1726755Species Achromobacter xylosoxidans [TaxId:85698] [189489] (27 PDB entries)
  8. 1726778Domain d5agfa_: 5agf A: [276644]
    automated match to d4cdaa_
    complexed with hem, no, so4

Details for d5agfa_

PDB Entry: 5agf (more details), 1.09 Å

PDB Description: nitrosyl complex of the d121q variant of cytochrome c prime from alcaligenes xylosoxidans
PDB Compounds: (A:) cytochrome c prime

SCOPe Domain Sequences for d5agfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5agfa_ a.24.3.2 (A:) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
efakpedavkyrqsaltlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
qayrk

SCOPe Domain Coordinates for d5agfa_:

Click to download the PDB-style file with coordinates for d5agfa_.
(The format of our PDB-style files is described here.)

Timeline for d5agfa_: