SCOPe 2.06: Domain d5abjb_: 5abj B:

Lineage for d5abjb_ (5abj B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.0: automated matches [191569] (1 protein)
   not a true family

6. Protein automated matches [190988] (13 species)
   not a true protein

7. Species Coxsackievirus a16 [TaxId:31704] [276271] (3 PDB entries)

8. Domain d5abjb_: 5abj B: [276642]
   Other proteins in same PDB: d5abjc_
   automated match to d4jgyb_
   complexed with cl, na, ym2

Details for d5abjb_

PDB Entry: 5abj, 2.75 Å

PDB Description: structure of coxsackievirus a16 in complex with gpp3

PDB Compounds: (B:) vp2

SCOPe Domain Sequences for d5abjb_:

Sequence; same for both SEQRES and ATOM records:

>d5abjb_ b.121.4.0 (B:) automated matches {Coxsackievirus a16 [TaxId: 31704]}
sdrvaqltignstittqeaaniviaygewpeycpdtdatavdkptrpdvsvnrfftldtk
swakdskgwywkfpdvltevgvfgqnaqfhylyrsgfcvhvqcnaskfhqgallvavlpe
yvlgtiaggtgnenshppyattqpgqvgavlthpyvldagiplsqltvcphqwinlrtnn
catiivpymntvpfdsalnhcnfgllvipvvpldfnagatseipitvtiapmcaefaglr
qavkq

Timeline for d5abjb_:

• d5abjb_ first appeared in SCOPe 2.05
  
• d5abjb_ appears in SCOPe 2.07
  
• d5abjb_ appears in the current release, SCOPe 2.08