Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (49 species) not a true protein |
Species Escherichia coli [TaxId:83333] [260781] (4 PDB entries) |
Domain d3wr7d_: 3wr7 D: [276607] automated match to d4r9mc_ complexed with coa, spd |
PDB Entry: 3wr7 (more details), 2.5 Å
SCOPe Domain Sequences for d3wr7d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wr7d_ d.108.1.0 (D:) automated matches {Escherichia coli [TaxId: 83333]} hsvklrpleredlryvhqldnnasvmrywfeepyeafvelsdlydkhihdqserrfvvec dgekaglvelveinhvhrraefqiiispeyqgkglatraaklamdygftvlnlyklyliv dkenekaihiyrklgfsvegelmheffingqyrnairmcifqhqylaehk
Timeline for d3wr7d_: