Lineage for d4wp9b_ (4wp9 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1910831Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 1910910Family d.58.29.0: automated matches [191671] (1 protein)
    not a true family
  6. 1910911Protein automated matches [191274] (8 species)
    not a true protein
  7. 1910921Species Mycobacterium avium [TaxId:1764] [276597] (1 PDB entry)
  8. 1910923Domain d4wp9b_: 4wp9 B: [276598]
    automated match to d2w01c_
    complexed with ca, mg, zda

Details for d4wp9b_

PDB Entry: 4wp9 (more details), 1.38 Å

PDB Description: crystal structure of adenylyl cyclase ma1120 from mycobacterium avium bound to 2'5'-dd-3'-atp, calcium and magnesium ion
PDB Compounds: (B:) Ma1120

SCOPe Domain Sequences for d4wp9b_:

Sequence, based on SEQRES records: (download)

>d4wp9b_ d.58.29.0 (B:) automated matches {Mycobacterium avium [TaxId: 1764]}
amgsrvvilftdieestalnerigdrawvklisshdklvsdlvrrqsghvvksqgdgfmv
afarpeqavrcgielqralrrnanrkrheeirvrigihmgrsvrrgddlfgrnvamaarv
aaqaaggeilvsqpvrdalsrsdgirfddgrevelkgfsgtyrlfavl

Sequence, based on observed residues (ATOM records): (download)

>d4wp9b_ d.58.29.0 (B:) automated matches {Mycobacterium avium [TaxId: 1764]}
amgsrvvilftdieestalnerigdrawvklisshdklvsdlvrrqsghvvksqgdgfmv
afarpeqavrcgielqralrreirvrigihmgrsvrrgddlfgrnvamaarvaaqaagge
ilvsqpvrdalsrsdgirfddgrevelkgfsgtyrlfavl

SCOPe Domain Coordinates for d4wp9b_:

Click to download the PDB-style file with coordinates for d4wp9b_.
(The format of our PDB-style files is described here.)

Timeline for d4wp9b_: