Lineage for d4uwbb_ (4uwb B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1930369Protein Fibroblast growth factor receptor 1 [56158] (1 species)
    PTK group; FGFR subfamily; membrane spanning protein tyrosine kinase
  7. 1930370Species Human (Homo sapiens) [TaxId:9606] [56159] (29 PDB entries)
  8. 1930424Domain d4uwbb_: 4uwb B: [276596]
    automated match to d4v04b_
    complexed with edo, jvt, so4

Details for d4uwbb_

PDB Entry: 4uwb (more details), 2.31 Å

PDB Description: fibroblast growth factor receptor 1 kinase in complex with jk-p5
PDB Compounds: (B:) fibroblast growth factor receptor 1

SCOPe Domain Sequences for d4uwbb_:

Sequence, based on SEQRES records: (download)

>d4uwbb_ d.144.1.7 (B:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
gvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlks
datekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrp
pgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmk
iadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlgg
spypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldriv
altsnqe

Sequence, based on observed residues (ATOM records): (download)

>d4uwbb_ d.144.1.7 (B:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
gvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkpnrvtkvavkmlksda
tekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppg
leysyhnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfg
larhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpv
eelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnqe

SCOPe Domain Coordinates for d4uwbb_:

Click to download the PDB-style file with coordinates for d4uwbb_.
(The format of our PDB-style files is described here.)

Timeline for d4uwbb_: